Iright
BRAND / VENDOR: Proteintech

Proteintech, 14810-1-AP, DCUN1D5 Polyclonal antibody

CATALOG NUMBER: 14810-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DCUN1D5 (14810-1-AP) by Proteintech is a Polyclonal antibody targeting DCUN1D5 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 14810-1-AP targets DCUN1D5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, U-937 cells, MDA-MB-231 cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Conjugation of Nedd8 to a cullin protein, termed neddylation, is an evolutionarily conserved process that functions to activate the cullin-RING family E3 ubiquitin ligases, leading to increased proteasomal degradation of a wide range of substrate proteins. Cellular neddylation requires the action of DCN1 (Defective in cullin neddylation protein 1), which, in humans, consists of five homologues designated as DCNL1-5. DCUN1D5 gene encodes the 28 kDa DCUN1 domain-containing protein 5 containing a C-terminal potentiating neddylation domain. The cellular function of DCUN1D5 needs to be explored, recently, a mono-ubiquitination-mediated mechanism that governs nuclear-cytoplasmic trafficking of hDCNL1, was reported to regulate hDCNL1-dependent activation of the cullin-RING E3 ubiquitin ligases in selected cellular compartments. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6534 Product name: Recombinant human DCUN1D5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-237 aa of BC004169 Sequence: MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGMEKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKNIYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHADLSNYDEDGAWPVLLDEFVEWQKVRQTS Predict reactive species Full Name: DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC004169 Gene Symbol: DCUN1D5 Gene ID (NCBI): 84259 RRID: AB_2088468 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BTE7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924