Proteintech, 14811-1-AP, DEXI Polyclonal antibody

Size: 20ul / 150ul The DEXI (14811-1-AP) by Proteintech is a Polyclonal antibody targeting DEXI in IHC, ELISA applications with reactivity to human, mouse, rat samples 14811-1-AP targets DEXI in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information DEXI, also named as MYLE, is a potential marker for glucocorticoid responsiveness in treated patients and may play a role in modulating the function of inflammatory proteins. It is a 95 residues acidic protein. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6535 Product name: Recombinant human DEXI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC001083 Sequence: MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE Predict reactive species Full Name: dexamethasone-induced transcript Calculated Molecular Weight: 10 kDa GenBank Accession Number: BC001083 Gene Symbol: DEXI Gene ID (NCBI): 28955 RRID: AB_2092618 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95424 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.