Proteintech, 14828-1-AP, PIG3 Polyclonal antibody

Size: 20ul / 150ul The PIG3 (14828-1-AP) by Proteintech is a Polyclonal antibody targeting PIG3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 14828-1-AP targets PIG3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, SMMC-7721 cells Positive IP detected in: MCF-7 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6618 Product name: Recombinant human TP53I3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-332 aa of BC000474 Sequence: MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ Predict reactive species Full Name: tumor protein p53 inducible protein 3 Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 34-36 kDa GenBank Accession Number: BC000474 Gene Symbol: TP53I3 Gene ID (NCBI): 9540 RRID: AB_2206893 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q53FA7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.