Proteintech, 14874-1-AP, COQ9 Polyclonal antibody

Size: 20ul / 150ul The COQ9 (14874-1-AP) by Proteintech is a Polyclonal antibody targeting COQ9 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14874-1-AP targets COQ9 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, mouse liver tissue, rat liver tissue Positive IP detected in: HeLa cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information COQ9, also named as C16orf49, HSPC326, and PSEC0129, is a 318 amino acid protein, which belongs to the COQ9 family. COQ9 localizes in the Mitochondrion and is involved in the biosynthesis of coenzyme Q COQ9 has abilities to improve left ventricular performance and to reduce myocardial infarct size and cardiomyocyte apoptosis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6645 Product name: Recombinant human COQ9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-318 aa of BC064946 Sequence: MAAAAVSGALGRAGWRLLQLRCLPVARCRQALVPRAFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR Predict reactive species Full Name: coenzyme Q9 homolog (S. cerevisiae) Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC064946 Gene Symbol: COQ9 Gene ID (NCBI): 57017 RRID: AB_2082218 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75208 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.