Iright
BRAND / VENDOR: Proteintech

Proteintech, 14879-1-AP, BTG1 Polyclonal antibody

CATALOG NUMBER: 14879-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BTG1 (14879-1-AP) by Proteintech is a Polyclonal antibody targeting BTG1 in IHC, ELISA applications with reactivity to human, mouse, rat samples 14879-1-AP targets BTG1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human thyroid cancer tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information BTG1 is a member of the TOB/BTG family of proteins known to inhibit cell proliferation and negatively regulate the cell cycle (PMID: 25017022). It is strongly expressed in quiescent cells (maximal in the G0/G1 phase) and down-regulated as the cells enter the growth cycle (PMID: 1373383). BTG1 protein is localized in cytoplasm and nucleus, and can interact with CAF1 and PRMT1 (PMID: 1113675, 9712883, 26622543). The aberration of BTG1 expression is associated with B-cell lymphocytic leukemia, and may serve as a diagnostic indicator and prognostic marker of thyroid carcinoma (PMID: 2069907, 25017022). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6651 Product name: Recombinant human BTG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC064953 Sequence: MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG Predict reactive species Full Name: B-cell translocation gene 1, anti-proliferative Calculated Molecular Weight: 19 kDa GenBank Accession Number: BC064953 Gene Symbol: BTG1 Gene ID (NCBI): 694 RRID: AB_2067644 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62324 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924