Proteintech, 14893-1-AP, ATP5D Polyclonal antibody

Size: 20ul / 150ul ATP5D Polyclonal Antibody for WB, IHC, ELISA 14893-1-AP targets ATP5D in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, NIH/3T3 cells, HeLa cells, HepG2 cells Positive IHC detected in: human liver cancer tissue, human lung cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:600 Background Information The mitochondrial F1Fo-ATP synthase complex uses energy derived from a proton gradient to synthesize ATP. The ATP5D gene encodes the delta subunit of the mitochondrial ATP synthase F1 complex and belongs to the ATPase epsilon chain family. This gene encode the full length protein of 17 kDa with a transit peptide of 22 amino acid. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6682 Product name: Recombinant human ATP5D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-168 aa of BC002389 Sequence: MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE Predict reactive species Full Name: ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 15-17 kDa GenBank Accession Number: BC002389 Gene Symbol: ATP5D Gene ID (NCBI): 513 RRID: AB_2274510 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30049 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.