Iright
BRAND / VENDOR: Proteintech

Proteintech, 14908-1-AP, QDPR Polyclonal antibody

CATALOG NUMBER: 14908-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The QDPR (14908-1-AP) by Proteintech is a Polyclonal antibody targeting QDPR in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 14908-1-AP targets QDPR in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, human liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Dihydropteridine reductase (QDPR), also named as DHPR and HDHPR, is an essential enzyme in the hydroxylating system of the aromatic amino acids, since it catalyses the regeneration of tetrahydrobiopterin (BH4), the natural cofactor of phenylalanine, tyrosine, and tryptophan hydroxylases, from the quininoid-dihydrobiopterin produced in these coupled reactions(PMID:8326489). The QDPR protein is active as a dimer, with a subunit Mr of 26 kDa(PMID:7627180). This protein belongs to the short-chain dehydrogenases/reductases (SDR) family. Defects in QDPR are the cause of BH4-deficient hyperphenylalaninemia type C (HPABH4C)(PMID:11153907). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6705 Product name: Recombinant human QDPR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-244 aa of BC000576 Sequence: MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF Predict reactive species Full Name: quinoid dihydropteridine reductase Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC000576 Gene Symbol: QDPR Gene ID (NCBI): 5860 RRID: AB_2173013 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09417 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924