Proteintech, 14958-1-AP, RBM8A,Y14 Polyclonal antibody

Size: 20ul / 150ul The RBM8A,Y14 (14958-1-AP) by Proteintech is a Polyclonal antibody targeting RBM8A,Y14 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14958-1-AP targets RBM8A,Y14 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, Jurkat cells, HeLa cells, MDA-MB-453s cells Positive IP detected in: HeLa cells Positive IHC detected in: human brain tissue, human spleen tissue, human testis tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6800 Product name: Recombinant human RBM8A,Y14 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-174 aa of BC017088 Sequence: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR Predict reactive species Full Name: RNA binding motif protein 8A Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC017088 Gene Symbol: RBM8A Gene ID (NCBI): 9939 RRID: AB_2178820 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5S9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.