Proteintech, 14984-1-AP, MCTS1 Polyclonal antibody

Size: 20ul / 150ul The MCTS1 (14984-1-AP) by Proteintech is a Polyclonal antibody targeting MCTS1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 14984-1-AP targets MCTS1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, mouse bladder tissue, K-562 cells, MOLT-4 cells, Raji cells Positive IP detected in: K-562 cells Positive IHC detected in: human ovarian cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information MCTS1 is an anti-oncogene that plays a role in cell cycle regulation. It can reduce cell doubling time and anchor-dependent growth. The G1 transition time and the duration of the G1 / S transition are shortened. It can also promote the release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits (PMID: 10440924). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6968 Product name: Recombinant human MCTS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC001013 Sequence: MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK Predict reactive species Full Name: malignant T cell amplified sequence 1 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 18-21 kDa GenBank Accession Number: BC001013 Gene Symbol: MCTS1 Gene ID (NCBI): 28985 RRID: AB_2878096 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULC4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.