Iright
BRAND / VENDOR: Proteintech

Proteintech, 14986-1-AP, MGLL Polyclonal antibody

CATALOG NUMBER: 14986-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MGLL (14986-1-AP) by Proteintech is a Polyclonal antibody targeting MGLL in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 14986-1-AP targets MGLL in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells, SMMC-7721 cells Positive IP detected in: mouse liver tissue Positive IHC detected in: human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:300-1:600 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information MGLL (monoglyceride lipase) is also named as MAGL, HU-K5 and belongs to the monoacylglycerol lipase family. It converts monoacylglycerides to free fatty acids and glycerol and functions together with hormone-sensitive lipase (HSL) in the mobilization of fatty acids from the triglyceride stores of adipocytes. MGL protein is ubiquitously expressed in kidney, spleen, heart, liver, stomach, brain, lung, adrenal gland, adipose tissue and in brain,there are two bands of 33 kDa and 35 kDa can be detected. The single protein species expressed in muscle is larger (around 40 kDa) (PMID:11470505). This protein can exsit as a homodimer (PMID:19957260). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6970 Product name: Recombinant human MGLL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-313 aa of BC000551 Sequence: METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP Predict reactive species Full Name: monoglyceride lipase Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC000551 Gene Symbol: MGLL Gene ID (NCBI): 11343 RRID: AB_2143189 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99685 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924