Proteintech, 14987-1-AP, S100A13 Polyclonal antibody

Size: 20ul / 150ul The S100A13 (14987-1-AP) by Proteintech is a Polyclonal antibody targeting S100A13 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14987-1-AP targets S100A13 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells Positive IHC detected in: human thyroid cancer tissue, human brain tissue, human heart tissue, human kidney tissue, human lung tissue, human ovary tissue, human placenta tissue, human skin tissue, human spleen tissue, human testis tissue, human thyroid tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6971 Product name: Recombinant human S100A13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC000632 Sequence: MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK Predict reactive species Full Name: S100 calcium binding protein A13 Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC000632 Gene Symbol: S100A13 Gene ID (NCBI): 6284 RRID: AB_2878097 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99584 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.