Iright
BRAND / VENDOR: Proteintech

Proteintech, 14994-1-AP, METTL1 Polyclonal antibody

CATALOG NUMBER: 14994-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The METTL1 (14994-1-AP) by Proteintech is a Polyclonal antibody targeting METTL1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14994-1-AP targets METTL1 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HuH-7 cells, HeLa cells, rat brain tissue, mouse brain tissue Positive IP detected in: A2780 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information METTL1 methyltransferase mediates m7G methylation within miRNAs and regulates cell migration via its catalytic activity. METTL1 can be inactivated by phosphorylation at Ser27 by protein kinase B (PKBα). Overexpression of METTL1 is widely observed among human cancers. It is also crucial for the regulation of chemoresistance in cancer treatment. In addition, mutations in the human N7-methylguanosine (m7G) methyltransferase complex METTL1/WDR4 cause primordial dwarfism and brain malformation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6980 Product name: Recombinant human METTL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-276 aa of BC000550 Sequence: MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH Predict reactive species Full Name: methyltransferase like 1 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC000550 Gene Symbol: METTL1 Gene ID (NCBI): 4234 RRID: AB_2142013 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBP6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924