Proteintech, 15000-1-AP, UNKL Polyclonal antibody

Size: 20ul / 150ul The UNKL (15000-1-AP) by Proteintech is a Polyclonal antibody targeting UNKL in WB, ELISA applications with reactivity to human, mouse, rat samples 15000-1-AP targets UNKL in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Putative E3 ubiquitin-protein ligase UNKL was expressed at significantly lower levels in endometrial tumor tissues as compared to the endometrium. Importantly, in human endometrial cancer, primary tumor expression of UNKL was correlated with overall survival in black patients with high mutational burden. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6990 Product name: Recombinant human UNKL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-229 aa of BC000150 Sequence: MTCCSQVPPRRRPSLALSPRLDCNGLNGVPGSIWDFVSGSFSPSPSPILSAGPPSSSSASPNGAELARVRRQLDEAKRKIRQWEESWQQVKQVCDAWQREAQEAKERARVADSDRQLALQKKEEVEAQVKQLQEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGVIFQLRAKQCVACRERAHGAVLRPCQHHILCEPCAATAPECPYCKGQPLQW Predict reactive species Full Name: unkempt homolog (Drosophila)-like Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 32 kDa, 45 kDa GenBank Accession Number: BC000150 Gene Symbol: UNKL Gene ID (NCBI): 64718 RRID: AB_2213189 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H9P5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.