Iright
BRAND / VENDOR: Proteintech

Proteintech, 15020-1-AP, Cathepsin A Polyclonal antibody

CATALOG NUMBER: 15020-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Cathepsin A (15020-1-AP) by Proteintech is a Polyclonal antibody targeting Cathepsin A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15020-1-AP targets Cathepsin A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, Sp2/0 cells, PC-3 cells, DU 145 cells Positive IHC detected in: human liver tissue, human breast cancer tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:750-1:3000 Background Information CTSA is also named as PPGB(protective protein for beta-galactosidase), PPCA(protective protein cathepsin A), cathepsin A, carboxypeptidase C, carboxypeptidase L and belongs to the peptidase S10 family. It is a ubiquitously expressed multifunctional enzyme, with deamidase, esterase, and carboxypeptidase activities and a preference for substrates with hydrophobic amino acid residues at the P1-prime position. It can be cleaved into the following 2 chains and defects in CTSA are the cause of galactosialidosis (GSL). This protein has 2 glycosylation sites. CTSA is synthesized as a 54-kDa precursor protein and composed of 32- and 20-kDa subunits linked together by disulfide bonds(PMID: 16461364,19574551). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7073 Product name: Recombinant human CTSA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 133-479 aa of BC000597 Sequence: FSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY Predict reactive species Full Name: cathepsin A Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 54-60, 32, 20 kDa GenBank Accession Number: BC000597 Gene Symbol: Cathepsin A Gene ID (NCBI): 5476 RRID: AB_10696309 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10619 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924