Iright
BRAND / VENDOR: Proteintech

Proteintech, 15032-1-AP, PHF17 Polyclonal antibody

CATALOG NUMBER: 15032-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PHF17 (15032-1-AP) by Proteintech is a Polyclonal antibody targeting PHF17 in WB, ELISA applications with reactivity to human samples 15032-1-AP targets PHF17 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information PHF17 was identified as a protein partner of the von Hippel-Lindau tumor suppressor pVHL. It is one component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. It can act as a transcriptional coactivator that promote acetylation of nucleosomal histone H4 by KAT5. In addition, it ubiquitinates both phosphorylated and non-phosphorylated β-catenin and therefore regulates canonical Wnt signaling in both Wnt-off and Wnt-on phases. PHF17 exist several isoforms with molecular weight 100-110 and 55-65 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4290 Product name: Recombinant human PHF17 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-300 aa of BC032376 Sequence: MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRTDLITAMKLHDSYQLNPDEYYVLADPWRQEWEKGVQVPVSPGTIPQPVARVVSEEKSLMFIRPKKYIVSSGSEPPELGYVDIRTLADSVCRYDLNDMDAAWLELTNEEFKEMGMPELDEYTMERVLEEFEQRCYDNMNHAIETEEGLGIEYDEDVVCDVCQSPDGEDGNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPI Predict reactive species Full Name: PHD finger protein 17 Calculated Molecular Weight: 96 kDa Observed Molecular Weight: 65 kDa, 100-110 kDa GenBank Accession Number: BC032376 Gene Symbol: PHF17 Gene ID (NCBI): 79960 RRID: AB_2165238 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6IE81 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924