Iright
BRAND / VENDOR: Proteintech

Proteintech, 15039-1-AP, CMTM8 Polyclonal antibody

CATALOG NUMBER: 15039-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CMTM8 (15039-1-AP) by Proteintech is a Polyclonal antibody targeting CMTM8 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 15039-1-AP targets CMTM8 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse bladder tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human liver tissue, human pancreas tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information CMTM8, also known as CKLFSF8, is a member of the chemokine-like factor superfamily (CKLFSF). Proteins of this family share similarity with both the chemokine and the transmembrane 4 superfamilies. CMTM8 is an attenuator of EGF-induced signaling (PMID: 16263120). Overexpression of CMTM8 accelerates ligand-induced clearance of EGFR from the cell surface and induces apoptosis via caspase-dependent and -independent pathways (PMID: 17149703). An alternative splice form of CMTM8, CMTM8-v2, arises from a deletion of exon 2. CMTM8-v2 maintains the ability to induce apoptosis (PMID: 17681841). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6776 Product name: Recombinant human CMTM8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-173 aa of BC041390 Sequence: MEEPQRARSHTVTTTASSFAENFSTSSSSFAYDREFLRTLHGFLIVAEIVLGLLVWTLIAGTEYFRVPAFGWVMFVAVSYWVLTVFFLIIYITMTYTRIPQVPWTTVGLCFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTIQ Predict reactive species Full Name: CKLF-like MARVEL transmembrane domain containing 8 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: BC041390 Gene Symbol: CMTM8 Gene ID (NCBI): 152189 RRID: AB_10949191 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IZV2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924