Proteintech, 15061-1-AP, DHRS7 Polyclonal antibody

Size: 20ul / 150ul The DHRS7 (15061-1-AP) by Proteintech is a Polyclonal antibody targeting DHRS7 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15061-1-AP targets DHRS7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DHRS7 (Dehydrogenase/Reductase (SDR family) member 7), also known as SDR34C1, retSDR4, is a member of a large family of short-chain dehydrogenases/reductases (SDR). The DHRS7 gene codes for two subtypes and is found on chromosome 14. Isotype 1 (38 kDa) has 339 amino acids, while isotype 2 (32 kDa) contains 289 amino acids (PMID: 26466768). DHRS7 has been demonstrated to be an integral protein facing the lumen of the endoplasmic reticulum with lack of posttranscriptional glycosylation modification(PMID: 24246760). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7064 Product name: Recombinant human DHRS7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-183 aa of BC000637 Sequence: RADGDLTLLWAEWQGRRPEWELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQG Predict reactive species Full Name: dehydrogenase/reductase (SDR family) member 7 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 32-38 kDa GenBank Accession Number: BC000637 Gene Symbol: DHRS7 Gene ID (NCBI): 51635 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y394 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.