Iright
BRAND / VENDOR: Proteintech

Proteintech, 15075-1-AP, SUOX Polyclonal antibody

CATALOG NUMBER: 15075-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SUOX (15075-1-AP) by Proteintech is a Polyclonal antibody targeting SUOX in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15075-1-AP targets SUOX in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human liver tissue, L02 cells, mouse liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hela cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information SUOX(sulfite oxidase) catalyzes the oxidation of sulfite to sulfate, the terminal reaction in the oxidative degradation pathway of the sulfur-containing amino acids cysteine and methionine. The enzyme is a dimer of identical subunits and is located in the intermembrane space of mitochondria(PMID:9600976). Defects in SUOX are the cause of isolated sulfite oxidase deficiency (ISOD). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7146 Product name: Recombinant human SUOX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 182-545 aa of BC065193 Sequence: RHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSP Predict reactive species Full Name: sulfite oxidase Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 52 kDa, 60 kDa GenBank Accession Number: BC065193 Gene Symbol: SUOX Gene ID (NCBI): 6821 RRID: AB_2198558 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51687 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924