Proteintech, 15093-1-AP, SCML1 Polyclonal antibody

Size: 20ul / 150ul The SCML1 (15093-1-AP) by Proteintech is a Polyclonal antibody targeting SCML1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 15093-1-AP targets SCML1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Sex comb on midleg-like 1 (SCML1) is a meiosis-specific protein and is an essential component of the meiotic dense body. SCML1 is preferentially expressed in germ stem cells of testis, therefore likely involved in spermatogenesis. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5107 Product name: Recombinant human SCML1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC026159 Sequence: MMSNSSSEIDVQEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNLDKKIDVIRRKVSKIQRFHARSLWTNHKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYSTDHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVLLKHLGVKLGTAVKLCYYIDRLKQGKCFEN Predict reactive species Full Name: sex comb on midleg-like 1 (Drosophila) Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC026159 Gene Symbol: SCML1 Gene ID (NCBI): 6322 RRID: AB_2153243 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UN30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.