Iright
BRAND / VENDOR: Proteintech

Proteintech, 15102-1-AP, IL-10RB Polyclonal antibody

CATALOG NUMBER: 15102-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IL-10RB (15102-1-AP) by Proteintech is a Polyclonal antibody targeting IL-10RB in WB, ELISA applications with reactivity to human, mouse, rat samples 15102-1-AP targets IL-10RB in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat skeletal muscle tissue, Jurkat cells, mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:300-1:1000 Background Information Interleukin-10 (IL-10) is an anti-inflammatory cytokine that plays a critical role in maintaining immune system balance. IL-10 signals through a receptor complex consisting of two molecules of the IL-10R alpha-chain (IL-10RA) and two molecules of the accessory IL-10R beta-chain (IL-10RB) (PMID: 22236434). IL-10RA and IL-10RB are members of the type II cytokine receptor family. IL-10RB, also known as IL-10R2 or CDw210b, is the signaling subunit of the IL-10R complex and is constitutively expressed in a variety of cell types (PMID: 24507158). Binding of IL-10 to the IL-10R complex leads to JAK1- and TYK2-mediated phosphorylation of STAT3 (PMID: 11244051; 10433356). IL-10RB is also shared by several other cytokines, including IL22, IL-26, IFN-γ, IL-28A/B and IL29 (PMID: 22236434). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7445 Product name: Recombinant human IL-10RB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-225 aa of BC001903 Sequence: LGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAV Predict reactive species Full Name: interleukin 10 receptor, beta Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 42-45 kDa GenBank Accession Number: BC001903 Gene Symbol: IL10RB Gene ID (NCBI): 3588 RRID: AB_10638926 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q08334 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924