Iright
BRAND / VENDOR: Proteintech

Proteintech, 15106-1-AP, PCSK4 Polyclonal antibody

CATALOG NUMBER: 15106-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PCSK4 (15106-1-AP) by Proteintech is a Polyclonal antibody targeting PCSK4 in WB, IHC, ELISA applications with reactivity to human samples 15106-1-AP targets PCSK4 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue, human placenta tissue Positive IHC detected in: human placenta tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Proprotein convertase subtilysin/Kexin Type4 (PCSK4) is a protein convertase enzymes in spermatozoa acrosome membrane, it has an important role in the acrosome reaction through endoproteolytic process that converts the precursor proteins into bioactive protein as a necessary substance to penetrate on the zona pellucida (PMID: 16040806 ). The molecular mass of pro-PCSK4 is 72kDa, and mature PCSK4 is 54 kDa (PMID: 16040806, 19109312). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4007 Product name: Recombinant human PCSK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-242 aa of BC036354 Sequence: MGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLSLLAVTLGGPVLCGMSMDLPLYAWLSRARATPTKPQVWLPAGT Predict reactive species Full Name: proprotein convertase subtilisin/kexin type 4 Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC036354 Gene Symbol: PCSK4 Gene ID (NCBI): 54760 RRID: AB_10644152 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UW60 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924