Proteintech, 15114-1-AP, FKBP1B Polyclonal antibody

Size: 20ul / 150ul The FKBP1B (15114-1-AP) by Proteintech is a Polyclonal antibody targeting FKBP1B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15114-1-AP targets FKBP1B in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U-937 cells, mouse brain tissue, mouse heart tissue, Jurkat cells Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7153 Product name: Recombinant human FKBP1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC002614 Sequence: MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC Predict reactive species Full Name: FK506 binding protein 1B, 12.6 kDa Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC002614 Gene Symbol: FKBP1B Gene ID (NCBI): 2281 RRID: AB_11182817 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P68106 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.