Proteintech, 15117-1-AP, LMOD1 Polyclonal antibody

Size: 20ul / 150ul The LMOD1 (15117-1-AP) by Proteintech is a Polyclonal antibody targeting LMOD1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 15117-1-AP targets LMOD1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse bladder tissue, mouse uterus tissue, HT-29 cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:400-1:1600 Background Information LMOD1 was initially identified as a 64-kDa autoantigen in an expression screen with sera from patients with Hashimoto's thyroiditis. Recently immunohistochemistry and immunoblotting of LMOD1 demonstrated its highly restrictive pattern of expression in SMC lineages,like adult aorta, and bladder. LMOD1 is also shown to exhibit an embryonic and adult expression pattern. These data identify LMOD1 as a new SMC-restricted gene associated with the SMC differentiated phenotype. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7176 Product name: Recombinant human LMOD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-269 aa of BC001755 Sequence: MEELEKELDVVDPDGSVPVGLRQRNQTEKQSTGVYNREAMLNFCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDEAGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGSDRNTGLSRDKDKKREEMKEVAKKEDDEKVKGGAPAAPPPPPPPLAPPLIMENLKNSLSPATQRKMGDKVLPAQEKNSRDQLLAAIRSSNLKQLKKVEVPKLLQ Predict reactive species Full Name: leiomodin 1 (smooth muscle) Calculated Molecular Weight: 67 kDa Observed Molecular Weight: 85 kDa, 64 kDa GenBank Accession Number: BC001755 Gene Symbol: LMOD1 Gene ID (NCBI): 25802 RRID: AB_2136682 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P29536 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.