Iright
BRAND / VENDOR: Proteintech

Proteintech, 15118-1-AP, HCCS Polyclonal antibody

CATALOG NUMBER: 15118-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HCCS (15118-1-AP) by Proteintech is a Polyclonal antibody targeting HCCS in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 15118-1-AP targets HCCS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human heart tissue, HeLa cells, MCF-7 cells Positive IP detected in: MCF-7 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information HCCS(Cytochrome c-type heme lyase) links covalently the heme group to the apoprotein of cytochrome C.The covalent attachment of heme by CCHL in the IMS is crucial for translocation of the precursor of cytochrome c and its trapping in the IMS(PMID:15359280 ).This protein has a calculated molecular mass of about 31 KDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7189 Product name: Recombinant human HCCS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-268 aa of BC001691 Sequence: MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS Predict reactive species Full Name: holocytochrome c synthase (cytochrome c heme-lyase) Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC001691 Gene Symbol: HCCS Gene ID (NCBI): 3052 RRID: AB_2114848 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P53701 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924