Iright
BRAND / VENDOR: Proteintech

Proteintech, 15119-1-AP, SCAMP2 Polyclonal antibody

CATALOG NUMBER: 15119-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SCAMP2 (15119-1-AP) by Proteintech is a Polyclonal antibody targeting SCAMP2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 15119-1-AP targets SCAMP2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, human liver tissue, mouse lung tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information SCAMP2 functions in post-Golgi recycling pathways. It acts as a recycling carrier to the cell surface. It couples Arf6-stimulated PLD activity to exocytosis and links this process to formation of fusion pores. SCAMP2 is marker for secretory vesicles and tobacco BY-2 cells as a model system. The MW of SCAMP2 is 36-39 kDa with modification. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7190 Product name: Recombinant human SCAMP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC001376 Sequence: MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKML Predict reactive species Full Name: secretory carrier membrane protein 2 Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC001376 Gene Symbol: SCAMP2 Gene ID (NCBI): 10066 RRID: AB_2184772 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15127 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924