Iright
BRAND / VENDOR: Proteintech

Proteintech, 15129-1-AP, ABLIM1 Polyclonal antibody

CATALOG NUMBER: 15129-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ABLIM1 (15129-1-AP) by Proteintech is a Polyclonal antibody targeting ABLIM1 in WB, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 15129-1-AP targets ABLIM1 in WB, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NCI-H1299 cells, HEK-293 cells, HeLa cells, Y79 cells Positive IF-P detected in: mouse skeletal muscle tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ABLIM1 (actin-binding LIM protein 1) is a member of the LIM-domain protein family, mediating interactions between actin filaments and cytoplasmic targets. ABLIM1 has been reported as a cell cortex protein specifically in non-erythrocytes, and is critical for the formation of dense interwoven cortical actin meshwork. Due to the alternative splicing, ABLIM1 has multiple isoforms with predicted masses of 52, 70, and 88 kDa, respectively(PMID: 9245787). The phosphorylation or binding with SUMO2 may result in higher MW. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7258 Product name: Recombinant human ABLIM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 55-401 aa of BC002448 Sequence: DIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPDQGINIYRKPPIYKQHAALAAQSKSSEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF Predict reactive species Full Name: actin binding LIM protein 1 Calculated Molecular Weight: 88 kDa Observed Molecular Weight: 48-52 kDa, 105-110 kDa GenBank Accession Number: BC002448 Gene Symbol: ABLIM1 Gene ID (NCBI): 3983 RRID: AB_2257767 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14639 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924