Iright
BRAND / VENDOR: Proteintech

Proteintech, 15133-1-AP, ADI1 Polyclonal antibody

CATALOG NUMBER: 15133-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADI1 (15133-1-AP) by Proteintech is a Polyclonal antibody targeting ADI1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15133-1-AP targets ADI1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue, rat colon tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information ADI1(acireductone dioxygenase 1 ) is also named as SIPL, ARD, APL1, HMFT1638, MTCBP-1, FLJ10913, MTCBP1 and belongs to the acireductone dioxygenase (ARD) family. It catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).The downregulation of ADI1 protein expression in human prostate cancer specimens argues that ADI1 potentially inhibits the growth that occurs during prostate cancer progression(PMID:17786183). It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7274 Product name: Recombinant human ADI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-179 aa of BC001467 Sequence: MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA Predict reactive species Full Name: acireductone dioxygenase 1 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC001467 Gene Symbol: ADI1 Gene ID (NCBI): 55256 RRID: AB_2305014 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BV57 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924