Iright
BRAND / VENDOR: Proteintech

Proteintech, 15141-1-AP, INPP5B Polyclonal antibody

CATALOG NUMBER: 15141-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The INPP5B (15141-1-AP) by Proteintech is a Polyclonal antibody targeting INPP5B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15141-1-AP targets INPP5B in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse spleen tissue, HeLa cells, human placenta tissue Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information INPP5B(Type II inositol 1,4,5-trisphosphate 5-phosphatase) is also named as OCRL2,5PTase, 75 kDa inositol polyphosphate-5-phosphatase and belongs to the inositol 1,4,5-trisphosphate 5-phosphatase type II family. This protein, originally described in platelets, is one of at least three known enzymes capable of dephosphorylating inositol-1,4,5-trisphosphate (IP3) to inositol-1,4-bisphosphate (IP2)(PMID:8125013). It has 4 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7315 Product name: Recombinant human INPP5B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-309 aa of BC058932 Sequence: MDQSVAIQETLAEGEYCVIAVQGVLCEGDSRQSRLLGLVRYRLEHGGQEHALFLYTHRRMAITGDDVSLDQIVPVSRDFTLEEVSPDGELYILGSDVTVQLDTAELSLVFQLPFGSQTRMFLHEVARACPGFDSATRDPEFLWLSRYRCAELELEMPTPRGCNSALVTWPGYATIGGGGSNFDGLRPNGKGVPMDQSSRGQDKPESLQPRQNKSKSEITDMVRSSTITVSDKAHILSMQKFGLRDTIVKSHLLQKEEDYTYIQNFRFFAGTYNVNGQSPKECLRLWLSNGIQAPDVYCVGFQELDLSKE Predict reactive species Full Name: inositol polyphosphate-5-phosphatase, 75kDa Calculated Molecular Weight: 113 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC058932 Gene Symbol: INPP5B Gene ID (NCBI): 3633 RRID: AB_2126133 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P32019 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924