Iright
BRAND / VENDOR: Proteintech

Proteintech, 15144-1-AP, PPIL1 Polyclonal antibody

CATALOG NUMBER: 15144-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPIL1 (15144-1-AP) by Proteintech is a Polyclonal antibody targeting PPIL1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15144-1-AP targets PPIL1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A375 cells, NIH/3T3 cells, HepG2 cells Positive IP detected in: NIH/3T3 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Peptidyl-prolyl isomerase (PPIase) catalyzes the interconversion of a specific Pro-imide bond between the cis and trans conformations. PPIL1 (Peptidyl-prolyl cis-trans isomerase-like 1) is up-regulated in human colon cancer cells and an siRNA-mediated knockdown of PPIL1 resulted in a reduced number of viable cell (PMID: 20368803). Expression of PPIL1 was shown to be ubiquitous across all adult tissues (with highest expression in the adrenal gland, testis and heart). PPIL1 is also known to participate in the spliceosome; a complex and dynamic protein and RNA complex responsible for splicing introns from pre-mRNA (PMID: 33220177, 8978786). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7436 Product name: Recombinant human PPIL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC003048 Sequence: MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG Predict reactive species Full Name: peptidylprolyl isomerase (cyclophilin)-like 1 Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC003048 Gene Symbol: PPIL1 Gene ID (NCBI): 51645 RRID: AB_2169603 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3C6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924