Proteintech, 15168-1-AP, SIGMAR1 Polyclonal antibody

Size: 20ul / 150ul The SIGMAR1 (15168-1-AP) by Proteintech is a Polyclonal antibody targeting SIGMAR1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, zebrafish samples 15168-1-AP targets SIGMAR1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples. Tested Applications Positive WB detected in: COLO 320 cells, mouse kidney tissue, mouse colon tissue, rat colon tissue Positive IHC detected in: human liver cancer tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information SIGMAR1, also named as OPRS1, SRBP, SIG-1R and AAG8, belongs to the ERG2 family. It is an endoplasmic reticulum chaperone that binds a wide variety of ligands, including neurosteroids, psychostimulants, and dextrobenzomorphans. SIGMAR1 is ubiquitously expressed, and is enriched in motor neurons of the brain and spinal cord. It plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. SIGMAR1 plays a role in several other cell functions including proliferation, survival and death. SDS-PAGE and Western blot analysis showed that SIGMAR1 has an apparent molecular mass of 28 kDa. SIGMAR1 has 5 isoforms with MW 21-27kDa and 12kDa. Specification Tested Reactivity: human, mouse, rat, zebrafish Cited Reactivity: human, mouse, rat, monkey, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7351 Product name: Recombinant human SIGMAR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-223 aa of BC004899 Sequence: SEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP Predict reactive species Full Name: sigma non-opioid intracellular receptor 1 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC004899 Gene Symbol: SIGMAR1 Gene ID (NCBI): 10280 RRID: AB_2301712 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99720 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.