Proteintech, 15186-1-AP, PRL3 Polyclonal antibody

Size: 20ul / 150ul The PRL3 (15186-1-AP) by Proteintech is a Polyclonal antibody targeting PRL3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15186-1-AP targets PRL3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Positive IHC detected in: human colon cancer tissue, human oesophagus cancer tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Phosphatase of regenerating liver-3 (PRL-3; also known as PTP4A3), encodes a 22-kDa protein that represents a novel class of a superfamily of protein tyrosine phosphatases (PTPs) that are ubiquitously expressed in various tumors. PRL3 was associated with primary tumor growth, tumor reoccurrence, and therapy resistance in many human cancers. This protein was also suggested as a marker to predict the relapse of gastric cancer and invasive breast cancer. (PMID: 22469786, PMID: 30157875) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7249 Product name: Recombinant human PRL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-148 aa of BC003105 Sequence: MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM Predict reactive species Full Name: protein tyrosine phosphatase type IVA, member 3 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 20-28 kDa GenBank Accession Number: BC003105 Gene Symbol: PTP4A3 Gene ID (NCBI): 11156 RRID: AB_2878115 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75365 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.