Iright
BRAND / VENDOR: Proteintech

Proteintech, 15218-1-AP, STIP1 Polyclonal antibody

CATALOG NUMBER: 15218-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The STIP1 (15218-1-AP) by Proteintech is a Polyclonal antibody targeting STIP1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15218-1-AP targets STIP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, A549 cells, HEK-293 cells, HepG2 cells, Jurkat cells, HeLa cells Positive IP detected in: Jurkat cells Positive IHC detected in: human liver cancer tissue, human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information STIP1, also named as Hop and NY-REN-11. Its expression is low in the hypothalamus. STIP1 has some isoforms with MW 62 kDa, 68 kDa and 59 kDa. Acts as a co-chaperone for HSP90AA1.Mediates the association of the molecular chaperones HSPA8/HSC70 and HSP90, Probably forms a complex composed of chaperones HSP90 and HSP70, co-chaperones STIP1/HOP, CDC37, PPP5C, PTGES3/p23, TSC1 and client protein TSC2. STIP1 interacts with PACRG, EEF1AKMT3, FLCN, FNIP1 and FNIP2 (PMID:24880080). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7388 Product name: Recombinant human STIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 195-543 aa of BC002987 Sequence: EIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR Predict reactive species Full Name: stress-induced-phosphoprotein 1 Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 61 kDa GenBank Accession Number: BC002987 Gene Symbol: STIP1 Gene ID (NCBI): 10963 RRID: AB_2255518 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31948 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924