Iright
BRAND / VENDOR: Proteintech

Proteintech, 15220-1-AP, RPAIN Polyclonal antibody

CATALOG NUMBER: 15220-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RPAIN (15220-1-AP) by Proteintech is a Polyclonal antibody targeting RPAIN in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 15220-1-AP targets RPAIN in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A375 cells, mouse ovary tissue, A2780 cells Positive IP detected in: A375 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information PAIN, also named as RIP, mediates the import of RPA complex into the nucleus, possibly via some interaction with importin beta. RPAIN has many isoforms with MW 25-27 kDa, 12 kDa and 16-19 kDa. The publication with PMID: 16135809 reported the MW 30 and 45 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7392 Product name: Recombinant human RPAIN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC004451 Sequence: MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWNALQSVENCPEDLAQLEELIDMAVLEEIQQELINQEQSIISEYEKSLQFDEKCLSIMLAEWEANPLICPVCTNLLS Predict reactive species Full Name: RPA interacting protein Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 30-45 kDa GenBank Accession Number: BC004451 Gene Symbol: RPAIN Gene ID (NCBI): 84268 RRID: AB_2180976 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86UA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924