Proteintech, 15239-1-AP, SMPD2 Polyclonal antibody

Size: 20ul / 150ul The SMPD2 (15239-1-AP) by Proteintech is a Polyclonal antibody targeting SMPD2 in WB, ELISA applications with reactivity to human, mouse samples 15239-1-AP targets SMPD2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SMPD2, Sphingomyelin phosphodiesterase 2, is also named as Lyso-platelet-activating factor-phospholipase C and neutral sphingomyelinase (nSMase). It is involved in the sphingolipid metabolism pathway, which can catalyze the hydrolysis of sphingomyelin to form ceramide and phosphocholine. Smpd2/Smpd3 double-mutant mice were found to have severe retardation of late embryonic and postnatal growth and delayed puberty, belonging to hypothalamus-induced combined pituitary hormone deficiency (PubMed: 15764706). Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7367 Product name: Recombinant human SMPD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC000038 Sequence: MKPNFSLRLRIFNLNCWGIPYLSKHRADRMRRLGDFLNQESFDLALLEEVWSEQDFQYLRQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHHGDWFSGKAVGLLVLHLSGMVLNAYVTHLHAEYNRQKDIYLAHRVAQAWELAQFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYVLYKAVSGFYISCKSFETTTGFDPHSGTPLSDHEALMATLFVRHSPPQQNPSSTHGPAERSP Predict reactive species Full Name: sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase) Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC000038 Gene Symbol: SMPD2 Gene ID (NCBI): 6610 RRID: AB_3085456 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60906 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.