Iright
BRAND / VENDOR: Proteintech

Proteintech, 15283-1-AP, HJURP Polyclonal antibody

CATALOG NUMBER: 15283-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HJURP (15283-1-AP) by Proteintech is a Polyclonal antibody targeting HJURP in WB, IHC, ELISA applications with reactivity to human samples 15283-1-AP targets HJURP in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-29 cells, A549 cells, HeLa cells, MCF-7 cells Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Holliday Junction Recognition Protein (HJURP, also known as hFLEG1) is a centromeric protein with a pivotal role in the incorporation and maintenance of histone H3-like variant Centromere Protein-A (CENP-A) in centromeres. It is a specific chaperone for CENP-A and it integrates newly synthesized CENP-A molecules and nucleosomes at replicated centromeres. (PMID: 28819432, PMID: 31492860) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7402 Product name: Recombinant human HJURP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 394-748 aa of BC001940 Sequence: ATYNLDEENRFRTLKWLISPVKIVSRPTIRQGHGENRQREIEIRFDQLHREYCLSPRNQPRRMCLPDSWAMNMYRGGPASPGGLQGLETRRLSLPSSKAKAKSLSEAFENLGKRSLEAGRCLPKSDSSSSLPKTNPTHSATRPQQTSDLHVQGNSSGIFRKSVSPSKTLSVPDKEVPGHGRNRYDEIKEEFDKLHQKYCLKSPGQMTVPLCIGVSTDKASMEVRYQTEGFLGKLNPDPHFQGFQKLPSSPLGCRKSLLGSTAIEAPSSTCVARAITRDGTRDHQFPAKRPRLSEPQGSGRQGNSLGASDGVDNTVRPGDQGSSSQPNSEERGENTSYRMEEKSDFMLEKLETKSV Predict reactive species Full Name: Holliday junction recognition protein Calculated Molecular Weight: 86 kDa Observed Molecular Weight: 84 kDa GenBank Accession Number: BC001940 Gene Symbol: HJURP Gene ID (NCBI): 55355 RRID: AB_2116879 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NCD3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924