Proteintech, 15287-1-AP, HSPB8 Polyclonal antibody

Size: 20ul / 150ul The HSPB8 (15287-1-AP) by Proteintech is a Polyclonal antibody targeting HSPB8 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15287-1-AP targets HSPB8 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Neuro-2a cells, SGC-7901 cells, mouse brain tissue, HEK-293 cells, mouse heart tissue, rat heart tissue Positive IHC detected in: human heart tissue, human brain tissue, human kidney tissue, human lung tissue, human ovary tissue, human placenta tissue, human skin tissue, human spleen tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The Heat Shock Protein B8 (HSPB8), also named small stress protein-like protein (sHSP22), protein kinase H11(H11), E2-induced gene 1 protein (E2IG1), or alpha-crystallin C chain (CRYAC), is a small chaperone involved in chaperone-assisted selective autophagy (CASA) (PMID: 33562660). HSPB8 is expressed at relatively high levels in the heart and the skeletal muscle tissue. HSPB8 is composed of 196 amino acids with an apparent molecular mass of 21.6 kDa (PMID: 20570967). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7456 Product name: Recombinant human HSPB8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC002673 Sequence: MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT Predict reactive species Full Name: heat shock 22kDa protein 8 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 20-22 kDa GenBank Accession Number: BC002673 Gene Symbol: HSPB8 Gene ID (NCBI): 26353 RRID: AB_2248640 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UJY1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.