Proteintech, 15321-1-AP, PAM16 Polyclonal antibody

Size: 20ul / 150ul The PAM16 (15321-1-AP) by Proteintech is a Polyclonal antibody targeting PAM16 in WB, IHC, ELISA applications with reactivity to human samples 15321-1-AP targets PAM16 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PAM16, also named as Magmas, TIM16 and TIMM16, is regulates ATP-dependent protein translocation into the mitochondrial matrix. The MW of PAM16 is about 14-16 kDa in WB detection. PAM16 is a component of the PAM complex at least composed of a mitochondrial HSP70 protein, GRPEL1 or GRPEL2, TIMM44, TIMM16/PAM16 and TIMM14/DNAJC19. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0970 Product name: Recombinant human PAM16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC005024 Sequence: MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERP Predict reactive species Full Name: mitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC005024 Gene Symbol: PAM16 Gene ID (NCBI): 51025 RRID: AB_2878126 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3D7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.