Iright
BRAND / VENDOR: Proteintech

Proteintech, 15346-1-AP, CKMT1A Polyclonal antibody

CATALOG NUMBER: 15346-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CKMT1A (15346-1-AP) by Proteintech is a Polyclonal antibody targeting CKMT1A in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 15346-1-AP targets CKMT1A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat heart tissue, human colon tissue, human testis tissue, mouse heart tissue, mouse testis tissue, HEK-293 cells, A549 cells Positive IP detected in: mouse heart tissue Positive IHC detected in: human colon cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information CKMT1A(Creatine kinase U-type, mitochondrial) is also named CKMT and belongs to the ATP:guanido phosphotransferase family. CKMT1A is a nearly identical copy of the CKMT1B gene. Both genes encode an identical CKMT1 protein(PMID:17098888). It reversibly catalyzes the transfer of phosphate between ATP and various phosphates. It has 2 isoforms produced by alternative splicing with the molecular weight of 47 kDa and 50 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, sus scrofa domesticus (domestic pig) Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7583 Product name: Recombinant human CKMT1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 41-417 aa of BC001926 Sequence: SERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH Predict reactive species Full Name: creatine kinase, mitochondrial 1A Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC001926 Gene Symbol: CKMT1A Gene ID (NCBI): 548596 RRID: AB_2081073 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P12532 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924