Iright
BRAND / VENDOR: Proteintech

Proteintech, 15349-1-AP, CRIP1 Polyclonal antibody

CATALOG NUMBER: 15349-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRIP1 (15349-1-AP) by Proteintech is a Polyclonal antibody targeting CRIP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 15349-1-AP targets CRIP1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, PC-3 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CRIP1 also known as CRIP, CRP1, belongs to the LIM/double zinc finger protein family. CRIP1 has a unique double zinc finger motif, which is mainly expressed in the intestine, and may be involved in intestinal zinc transport (PMID: 31312368, 1946385). CRIP1 is overexpressed in immune cells of the epithelium and may play an important role in gut immunity(PMID: 27836662). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7588 Product name: Recombinant human CRIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC002738 Sequence: MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK Predict reactive species Full Name: cysteine-rich protein 1 (intestinal) Calculated Molecular Weight: 9 kDa Observed Molecular Weight: 8-9 kDa GenBank Accession Number: BC002738 Gene Symbol: CRIP1 Gene ID (NCBI): 1396 RRID: AB_2878128 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50238 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924