Iright
BRAND / VENDOR: Proteintech

Proteintech, 15368-1-AP, COX8A Polyclonal antibody

CATALOG NUMBER: 15368-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The COX8A (15368-1-AP) by Proteintech is a Polyclonal antibody targeting COX8A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15368-1-AP targets COX8A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, human skeletal muscle tissue Positive IHC detected in: mouse heart tissue, human hepatocirrhosis tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information COX8A(Cytochrome c oxidase subunit 8A) is also named as COX8, COX8L and belongs to the cytochrome c oxidase VIII family. This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. The gene encodes a full length protein of 8 kDa with a transit peptide of 25 amino acid. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2885 Product name: Recombinant human COX8A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-69 aa of BC063025 Sequence: MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE Predict reactive species Full Name: cytochrome c oxidase subunit 8A (ubiquitous) Calculated Molecular Weight: 8 kDa Observed Molecular Weight: 8 kDa GenBank Accession Number: BC063025 Gene Symbol: COX8A Gene ID (NCBI): 1351 RRID: AB_10697832 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10176 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924