Proteintech, 15391-1-AP, BRCC3 Polyclonal antibody

Size: 20ul / 150ul The BRCC3 (15391-1-AP) by Proteintech is a Polyclonal antibody targeting BRCC3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15391-1-AP targets BRCC3 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, MDA-MB-468 cells, NIH/3T3 cells, PC-3 cells Positive IHC detected in: human nasopharyngeal carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information BRCA1-BRCA2-containing complex subunit 3 (BRCC3), a Lys-63-specific deubiquitinase, is a member of the JAMM/MPN family of zinc metalloproteases. BRCC3 have been shown to promote the inflammasome activation by deubiquitinating NOD-like receptor containing pyrin domain 3 (NLRP3). BRCC3 is associated with G2/M arrest in breast cancer cells and DNA damage. The expression of BRCC3 is associated with increased cell proliferation. (PMID: 23246432, PMID: 30272359) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7584 Product name: Recombinant human BRCC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-316 aa of BC002999 Sequence: LESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE Predict reactive species Full Name: BRCA1/BRCA2-containing complex, subunit 3 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC002999 Gene Symbol: BRCC3 Gene ID (NCBI): 79184 RRID: AB_2092136 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P46736 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.