Proteintech, 15403-1-AP, YPEL3 Polyclonal antibody

Size: 20ul / 150ul The YPEL3 (15403-1-AP) by Proteintech is a Polyclonal antibody targeting YPEL3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15403-1-AP targets YPEL3 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: BxPC-3 cells Positive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information YPEL3 is part of a five-member family of closely related paralogues: YPEL1-5, which are named in reference to their Drosophila ortholgue. Studies showed shat YPEL3 is regulated by p53 and its encoding protein induces cellular senescence in human tumor and normal cells, indicating that YPEL3 is a p53-dependent, tumor suppressor gene. (PMID:20388804) 15403-1-AP was raised against full length of YPEL3 protein (1-119aa); it can recognize YPEL1-4. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7626 Product name: Recombinant human YPEL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-119 aa of BC005009 Sequence: MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD Predict reactive species Full Name: yippee-like 3 (Drosophila) Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC005009 Gene Symbol: YPEL3 Gene ID (NCBI): 83719 RRID: AB_11042587 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61236 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.