Iright
BRAND / VENDOR: Proteintech

Proteintech, 15423-1-AP, CDK2AP2 Polyclonal antibody

CATALOG NUMBER: 15423-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CDK2AP2 (15423-1-AP) by Proteintech is a Polyclonal antibody targeting CDK2AP2 in WB, ELISA applications with reactivity to human samples 15423-1-AP targets CDK2AP2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7730 Product name: Recombinant human CDK2AP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC002850 Sequence: MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART Predict reactive species Full Name: cyclin-dependent kinase 2 associated protein 2 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC002850 Gene Symbol: CDK2AP2 Gene ID (NCBI): 10263 RRID: AB_2878135 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75956 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924