Proteintech, 15426-1-AP, CD300LG Polyclonal antibody

Size: 20ul / 150ul The CD300LG (15426-1-AP) by Proteintech is a Polyclonal antibody targeting CD300LG in WB, IF/ICC, ELISA applications with reactivity to human samples 15426-1-AP targets CD300LG in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human kidney tissue, HepG2 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CD300LG, also known as CLM9 (CMRF35-like molecule 9), is a member of the CD300 protein family. Members of this family are cell surface glycoproteins with a single IgV-like extracellular domain, and are involved in the regulation of immune response. CD300LG is a receptor which may mediate L-selectin-dependent lymphocyte rollings and may play an important role in inflammation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8075 Product name: Recombinant human CD300LG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-332 aa of BC025395 Sequence: EISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPGPCCPPSPSPTFQPLATTRLQPKAKAQQTQPPGLTSPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLNSTSAEDTSPALSSGSSKPRVSIPMVRILAPVLVLLSLLSAAGLIAFCSHLLLWRKEAQQATETQRNEKFCLSRLTAEEKEAPSQAPEGDVISMPPLHTSEEELGFSKFVSA Predict reactive species Full Name: CD300 molecule-like family member g Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC025395 Gene Symbol: CD300LG Gene ID (NCBI): 146894 RRID: AB_2074217 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UXG3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.