Proteintech, 15434-1-AP, SSU72 Polyclonal antibody

Size: 20ul / 150ul The SSU72 (15434-1-AP) by Proteintech is a Polyclonal antibody targeting SSU72 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15434-1-AP targets SSU72 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells Positive IHC detected in: human liver tissue, human breast cancer tissue, human prostate cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7699 Product name: Recombinant human SSU72 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-194 aa of BC008070 Sequence: SNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY Predict reactive species Full Name: SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC008070 Gene Symbol: SSU72 Gene ID (NCBI): 29101 RRID: AB_2878138 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NP77 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.