Proteintech, 15472-1-AP, VPS24 Polyclonal antibody

Size: 20ul / 150ul The VPS24 (15472-1-AP) by Proteintech is a Polyclonal antibody targeting VPS24 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 15472-1-AP targets VPS24 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, human kidney tissue Positive IP detected in: HEK-293 cells, L02 cells Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7776 Product name: Recombinant human VPS24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC004419 Sequence: MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLRS Predict reactive species Full Name: vacuolar protein sorting 24 homolog (S. cerevisiae) Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC004419 Gene Symbol: VPS24 Gene ID (NCBI): 51652 RRID: AB_2217102 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3E7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.