Iright
BRAND / VENDOR: Proteintech

Proteintech, 15490-1-AP, SCNM1 Polyclonal antibody

CATALOG NUMBER: 15490-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SCNM1 (15490-1-AP) by Proteintech is a Polyclonal antibody targeting SCNM1 in IHC, ELISA applications with reactivity to human, mouse, rat samples 15490-1-AP targets SCNM1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SCNM1 is located at chromosome 1p21 which may contribute to human inherited dystonia. SCNM1 determines the proportion of correctly spliced transcripts and hence disease severity. It plays a role in RNA splicing, possibly contributing to the recognition of non-consensus donor sites. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7854 Product name: Recombinant human SCNM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-230 aa of BC000264 Sequence: MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRFACAICPHRPVLDTLAMLTAHRAGKKHLSSLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHRAPHYNSCCRRKYRPEAPGPSVSLSPMPPSEVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSSGWIPDGRGRWVKDENVEFDSDEEEPPDLPLD Predict reactive species Full Name: sodium channel modifier 1 Calculated Molecular Weight: 26 kDa GenBank Accession Number: BC000264 Gene Symbol: SCNM1 Gene ID (NCBI): 79005 RRID: AB_2184357 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BWG6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924