Product Description
Size: 20ul / 150ul
The Pancreatic Polypeptide (15493-1-AP) by Proteintech is a Polyclonal antibody targeting Pancreatic Polypeptide in IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples
15493-1-AP targets Pancreatic Polypeptide in IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: rat pancreas tissue
Positive FC (Intra) detected in: HepG2 cells
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:1000-1:4000
Immunofluorescence (IF)-P: IF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag7886 Product name: Recombinant human PPY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC032225 Sequence: MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL Predict reactive species
Full Name: pancreatic polypeptide
Calculated Molecular Weight: 10 kDa
GenBank Accession Number: BC032225
Gene Symbol: Pancreatic Polypeptide
Gene ID (NCBI): 5539
RRID: AB_2878145
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P01298
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924