Iright
BRAND / VENDOR: Proteintech

Proteintech, 15493-1-AP, Pancreatic Polypeptide Polyclonal antibody

CATALOG NUMBER: 15493-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Pancreatic Polypeptide (15493-1-AP) by Proteintech is a Polyclonal antibody targeting Pancreatic Polypeptide in IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 15493-1-AP targets Pancreatic Polypeptide in IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat pancreas tissue Positive FC (Intra) detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7886 Product name: Recombinant human PPY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC032225 Sequence: MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL Predict reactive species Full Name: pancreatic polypeptide Calculated Molecular Weight: 10 kDa GenBank Accession Number: BC032225 Gene Symbol: Pancreatic Polypeptide Gene ID (NCBI): 5539 RRID: AB_2878145 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01298 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924