Iright
BRAND / VENDOR: Proteintech

Proteintech, 15494-1-AP, RUNX1T1 Polyclonal antibody

CATALOG NUMBER: 15494-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RUNX1T1 (15494-1-AP) by Proteintech is a Polyclonal antibody targeting RUNX1T1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 15494-1-AP targets RUNX1T1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, Jurkat cells, HepG2 cells, HEK-293 cells, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information RUNX1T1 is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 gene fused to the 3'-region of this gene. Various transcript of the fusion gene has been reported. RUNX1T1 exists some isoforms with MV 68, 67,64, 48 and 44 kDa. The calcualted molecular weight of RUNX1T1 is 67 kDa, but modified RUNX1T1is about 70-75 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7892 Product name: Recombinant human RUNX1T1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC005850 Sequence: MPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREE Predict reactive species Full Name: runt-related transcription factor 1; translocated to, 1 (cyclin D-related) Calculated Molecular Weight: 68 kDa Observed Molecular Weight: 64-69 kDa GenBank Accession Number: BC005850 Gene Symbol: RUNX1T1 Gene ID (NCBI): 862 RRID: AB_2184217 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q06455 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924