Iright
BRAND / VENDOR: Proteintech

Proteintech, 15528-1-AP, CABC1 Polyclonal antibody

CATALOG NUMBER: 15528-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CABC1 (15528-1-AP) by Proteintech is a Polyclonal antibody targeting CABC1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15528-1-AP targets CABC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human skeletal muscle tissue, human heart tissue, mouse heart tissue, U-251 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CABC1 (Chaperone, ABC1 activity of bc1 complex homolog) is induced by the tumor suppressor p53 and is similar to the yeast ABC1, which is involved in an electron-transferring membrane protein complex in the respiratory chain. The CABC1 product was located in mitochondria, and may play an important role in mediating p53-inducible apoptosis. Four isoforms of CABC1 exist due to alternative splicing events. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7612 Product name: Recombinant human CABC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 300-647 aa of BC005171 Sequence: VRQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERPFAAASIGQVHLARMKGGREVAMKIQYPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELALECDYQREAACARKFRDLLKGHPFFYVPEIVDELCSPHVLTTELVSGFPLDQAEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAKSIEMKFLTGYEVKVMEDAHLDAILILGEAFASDEPFDFGTQSTTEKIHNLIPVMLRHRLVPPPEETYSLHRKMGGSFLICSKLKARFPCKAMFEEAYSNYCKRQAQQ Predict reactive species Full Name: chaperone, ABC1 activity of bc1 complex homolog (S. pombe) Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC005171 Gene Symbol: CABC1 Gene ID (NCBI): 56997 RRID: AB_2066403 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NI60 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924